PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00048.196
Common NameAMTR_s00048p00216350, LOC18443969
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRF
Protein Properties Length: 339aa    MW: 37888.8 Da    PI: 8.1503
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00048.196genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.31.7e-2570114145
                                       WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                               d+epgrCrRtDGKkWRCsr++++++k+CErH+hrgr+rsrk++e+
  evm_27.model.AmTr_v1.0_scaffold00048.196  70 DPEPGRCRRTDGKKWRCSRDAYPDSKYCERHMHRGRNRSRKPVEP 114
                                               79****************************************997 PP

2QLQ63.17.5e-22944237
                                       QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                                              +FT++Q+q+L++Q+l++K+L+a+ PvPp+Ll++i++
  evm_27.model.AmTr_v1.0_scaffold00048.196  9 PFTPSQWQELEHQALIFKHLMAGIPVPPDLLVPIRR 44
                                              9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-13844IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-16943IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.04944IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.90870114IPR014977WRC domain
PfamPF088792.2E-2171113IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MNSSGCRPPF TPSQWQELEH QALIFKHLMA GIPVPPDLLV PIRRSLEAMS ARFFQQQTMG  60
WGSFYGNKSD PEPGRCRRTD GKKWRCSRDA YPDSKYCERH MHRGRNRSRK PVEPQTVSHS  120
SQTSGALNQT GNSSFPNLPL HPITNPNSGS SGLCPGSNTS QLQVEHNTYG IGSKDYRYLQ  180
GMKEVDEHSF FSEASGSARA LGMEASLDNN WRLTPSRVSS FPISKARNGS ILQNNYPQLQ  240
NLEDLGNTTF PSALSKQQQH CFLGSEFRST ETMKVGQEQE GQPLRHFFDD WPKTRDSWAD  300
LEDERGNRTS FSTTQLSISI PMASSDFSAT SSQSPNND*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854210.10.0PREDICTED: growth-regulating factor 4
SwissprotQ6AWY62e-93GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLU5D2P70.0U5D2P7_AMBTC; Uncharacterized protein
STRINGVIT_16s0039g01450.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-52growth-regulating factor 5
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]